One Pot Creamy Garlic Pasta | Aioli Recipe
30-MINUTE MEALS! Get the email series now
Aiolirecipe

One Pot Creamy Garlic Pasta

5 from 1 vote
1 Comments
Olivia Bennett
By: Olivia BennettUpdated: Aug 5, 2026
This post may contain affiliate links. Please read our disclosure policy.

Silky, garlicky pasta made in a single pan — ready in minutes with pantry staples and a handful of simple techniques for restaurant-style creaminess.

One Pot Creamy Garlic Pasta

This one pot creamy garlic pasta has been my weeknight lifesaver for as long as I can remember. I discovered this approach on a rushed evening when I had only one skillet, a stubborn hunger, and a pantry full of basics. The result — tender strands of pasta cooked right in a garlicky, cheesy liquid — felt indulgent yet uncomplicated. The texture is the star here: the sauce clings to each noodle with a velvety sheen, thanks to the emulsion of milk, pasta starch and freshly grated Parmesan. It’s comfort-food simple but with a level of polish that makes it feel special.

What makes this dish so memorable is how quickly it brings people together. I served it the night a college roommate returned from a long trip; the kitchen smelled like garlic and warm milk, and we all lingered over bowls while recounting stories. The formula is forgiving: use spaghetti, linguine or penne, swap whole milk for what you have on hand, and add a spoonful of cream cheese or sour cream when you want extra richness. With a little attention to timing and stirring, you’ll get silky sauce without separate roux or heavy cream.

Why You'll Love This Recipe

  • This comes together in about 20 minutes using a single pan, making cleanup fast and perfect for busy weeknights.
  • It relies on pantry staples—dried pasta, garlic, milk, Parmesan—so you can make it even when the fridge is sparse.
  • The technique uses the pasta’s own starch to thicken the sauce, so no roux or heavy cream is required unless you want extra decadence.
  • Flexible ingredients mean it adapts to dietary tweaks: swap dairy for plant-based alternatives or add vegetables and proteins for a full meal.
  • Make-ahead friendly: leftovers refrigerate well and reheat gently with a splash of milk to restore creaminess.
  • Crowd-pleasing and comforting — even picky eaters typically go back for seconds.

In my experience, a gentle hand while stirring and using freshly grated Parmigiano-Reggiano instead of pre-grated varieties makes a noticeable difference. My family always comments on how bright the garlic tastes and how clean the sauce looks — no globs, no separation. It’s a small trick that produces a big payoff.

Ingredients

  • Pasta (8 ounces): Use spaghetti, linguine, or penne. I favor spaghetti for its sauce-clinging surface; buy a mid-range brand like Barilla or De Cecco for consistent texture. Measure dry by weight for accuracy.
  • Butter or olive oil (1 tablespoon): Butter gives a richer mouthfeel; extra-virgin olive oil keeps flavors bright and is better if you’re watching saturated fat.
  • Garlic (4 cloves, minced): Fresh garlic is essential—use a microplane or fine mince so it disperses evenly and releases aroma without biting chunks.
  • Milk (2 cups): Whole milk yields the creamiest finish; 2% or skim will work but the texture is lighter. Plant milks (oat, soy) are acceptable but choose unsweetened varieties.
  • Water (1 cup, or as needed): Just enough to cover the pasta. The exact amount varies by shape; reserve a cup of extra water to adjust consistency as it cooks.
  • Parmesan (3/4 cup, freshly grated): Fresh Parmigiano-Reggiano or Pecorino Romano grated at home melts smoothly and adds savory depth. Pre-grated powders often contain anti-caking agents that affect texture.
  • Salt (1/2 teaspoon): Start with this and adjust at the end — Parmesan brings saltiness, so taste before adding more.
  • Black pepper (1/4 teaspoon): Freshly cracked is best for aroma.
  • Italian seasoning (1 teaspoon): A simple blend of dried oregano, basil and thyme boosts herbaceous notes.
  • Optional - cream cheese or sour cream (2 tablespoons): Stir in at the end for a silkier, tangy finish.
  • Optional garnish: Chopped parsley or basil to freshen and add color.

Instructions

Prep the aromatics and dairy: Peel and finely mince 4 cloves of garlic so they release maximum flavor with minimal harshness. Measure the milk and have your water and cheese ready — freshly grate the Parmesan and set it beside the stove. This mise en place helps you add ingredients without scrambling. Heat the pan and bloom the garlic: Warm a wide, heavy skillet over medium heat and add 1 tablespoon butter or oil. Once melted and shimmering, add the garlic and cook 30–45 seconds until fragrant but not browned; burnt garlic tastes bitter. Lower the heat if the garlic sizzles aggressively. Add liquids and pasta: Pour in 2 cups milk and 1 cup water (or just enough to almost cover the pasta). Add the dry pasta and increase heat to bring the liquid to a gentle simmer. Stir to separate any strands so nothing clumps together. Simmer and stir frequently: Keep the mixture at a low simmer; cook uncovered for about 10–12 minutes, stirring every 1–2 minutes. As the pasta softens, it releases starch which thickens the liquid. If the pot looks dry before the pasta is al dente, add up to 1/2 cup more water in 1–2 tablespoon increments. Finish with cheese and seasoning: When the pasta is just tender (al dente) and the sauce has thickened, remove from heat and stir in 3/4 cup freshly grated Parmesan, 1/2 teaspoon salt, 1/4 teaspoon black pepper, and 1 teaspoon Italian seasoning. If using, whisk in 2 tablespoons cream cheese or sour cream off the heat for extra silkiness. The residual heat will melt the cheese into a glossy sauce. Adjust and serve: Taste and adjust salt and pepper. If the sauce feels too thick, loosen it with a splash of milk or reserved pasta water. Garnish with chopped parsley or basil and serve immediately for best texture. User provided content image 1

You Must Know

  • This dish is high in calcium and protein thanks to the milk and Parmesan, and freezes well for up to 3 months if stored airtight.
  • Leftovers keep in the refrigerator for 3–4 days; reheat gently with a splash of milk to restore creaminess and avoid drying out.
  • If you use lower-fat milk, the texture will be lighter; add 1 tablespoon butter or 1 tablespoon cream cheese to mimic the mouthfeel of whole milk.
  • Pasta water is your secret weapon: the starchy water helps bind the sauce and prevents separation when reheating or thinning.

One of my favorite things about this approach is how forgiving it is. I’ve made it on busy nights, during power outages using a single burner, and when feeding unexpected guests. The method consistently returns a glossy sauce and al dente pasta — small hands and hungry teens in my house always give it rave reviews.

User provided content image 2

Storage Tips

Cool leftovers quickly and store in airtight containers in the refrigerator for up to 3–4 days. For freezing, portion into meal-sized containers and freeze for up to 3 months; thaw overnight in the refrigerator before reheating. Reheat gently on the stove over low heat with 1–3 tablespoons of milk or reserved pasta water to loosen the sauce. Avoid microwaving on high as rapid heating can cause the sauce to separate; short bursts at medium power with stirring between cycles works if you must use the microwave.

Ingredient Substitutions

If you need to adjust for dietary needs, swap whole milk for unsweetened oat milk or soy milk for a dairy-free version and choose a granular vegan parmesan to finish. For a lactose-reduced version, try lactose-free milk and omit the optional cream cheese. You can substitute Pecorino Romano for Parmesan for a saltier, sharper finish — reduce added salt by half. To add protein, stir in cooked shredded chicken or white beans at the end; for extra vegetables, toss in baby spinach during the final minute so it wilts without becoming soggy.

Serving Suggestions

Serve in shallow bowls to showcase the glossy sauce and finish with a scattering of chopped parsley or basil for color. Pair with a crisp green salad dressed in lemon vinaigrette to cut through the richness, or roasted vegetables like broccoli or cherry tomatoes for textural contrast. This makes a cozy solo dinner or an easy centerpiece for a casual dinner party; add garlic-roasted shrimp on top for a restaurant-style upgrade.

Cultural Background

This creamy garlic preparation is rooted in Italian-American comfort cooking, inspired by classic methods that marry pasta and dairy. While traditional Italian sauces like carbonara and cacio e pepe rely on eggs or cheese emulsified with pasta water, this one-pot technique simplifies the process by cooking pasta directly in a milk-based liquid. It reflects the practical, resourceful nature of home cooking where convenience and flavor go hand in hand, adapting Old World flavors for contemporary kitchens.

Seasonal Adaptations

In spring, stir in blanched asparagus tips and peas for bright pops of color. In summer, add halved cherry tomatoes and a handful of fresh basil at the end. In autumn and winter, fold in roasted mushrooms or caramelized onions and top with toasted walnuts for warmth and texture. Adjust herbs to suit the season: lemon zest in summer, a sprinkle of nutmeg in winter for a subtle cozy note.

Meal Prep Tips

Double the recipe and portion into single-serving containers for easy lunches. Store sauce and pasta together; add a small container of grated Parmesan to sprinkle on top when reheating. Schedule reheating times so the meal finishes with the right texture—gentle reheating with a tablespoon of milk restores the sauce. Label containers with date and reheating instructions for quick weekday use.

Cooking is about small rituals that create comfort. This one pot method captures that spirit: minimal fuss, maximum satisfaction, and a few reliable techniques that elevate simple ingredients. Make it your own and enjoy the warm, garlicky hugs in a bowl.

Pro Tips

  • Use freshly grated Parmigiano-Reggiano for the creamiest melt; pre-grated cheese can cause a grainy texture.

  • Stir frequently while the pasta simmers to release starch and prevent sticking; don’t leave it unattended.

  • If the sauce tightens too much after resting, add 1–2 tablespoons of milk or reserved pasta water while reheating.

  • Taste before adding extra salt since the cheese contributes significant saltiness.

  • To boost richness without heavy cream, whisk in 2 tablespoons cream cheese off the heat.

This nourishing one pot creamy garlic pasta recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Comfort Foodpastaone-pot mealsgarliccreamyrecipesweeknight dinners
No ratings yet

One Pot Creamy Garlic Pasta

This One Pot Creamy Garlic Pasta recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
One Pot Creamy Garlic Pasta
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Instructions

1

Prepare ingredients

Mince garlic, measure milk and water, and grate Parmesan. Have all ingredients within arm’s reach to add them smoothly during cooking.

2

Sauté garlic

Heat a wide skillet over medium heat and melt butter or warm oil. Add minced garlic and sauté 30–45 seconds until fragrant but not browned to avoid bitterness.

3

Add liquids and pasta

Pour in 2 cups milk and 1 cup water (enough to nearly cover the pasta). Add dry pasta, increase heat to bring to a gentle simmer, and stir to separate strands.

4

Simmer while stirring

Maintain a low simmer and stir frequently for 10–12 minutes. Add small amounts of water if the liquid evaporates before the pasta is al dente; look for tender pasta with a slight bite.

5

Finish with cheese and seasoning

Remove from heat and stir in grated Parmesan, salt, pepper, and Italian seasoning. Optionally whisk in cream cheese or sour cream for extra creaminess. Adjust seasoning to taste.

6

Serve immediately

Garnish with chopped parsley or basil and serve while hot for the best texture and flavor. If reheating leftovers, add a splash of milk and warm gently.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 370kcal | Carbohydrates: 52g | Protein:
18g | Fat: 12g | Saturated Fat: 4g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
5g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@aiolirecipe on social media!

One Pot Creamy Garlic Pasta

Categories:

One Pot Creamy Garlic Pasta

Did You Make This?

Leave a comment & rating below or tag @aiolirecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Olivia!

Chef and recipe creator specializing in delicious Comfort Food cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.